PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g04910.1
Common NameLR48_Vigan10g021100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 410aa    MW: 46046.3 Da    PI: 4.696
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g04910.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.51.1e-071257342
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                    +r C+ + + ++++fC  ++ +lC+ C    H+       H++v+l
  Vang02g04910.1 12 ARACESCLKVRARWFCAADDAFLCHGCDNMVHSAnqlarrHERVKL 57
                    578******99*********************66888889999875 PP

2CCT675.2e-23360403144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Vang02g04910.1 360 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT 403
                     9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.2811057IPR000315B-box-type zinc finger
SMARTSM003366.6E-71057IPR000315B-box-type zinc finger
PfamPF006431.8E-51257IPR000315B-box-type zinc finger
CDDcd000214.14E-61357No hitNo description
PfamPF062039.3E-18360402IPR010402CCT domain
PROSITE profilePS5101715.993360402IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MKEASALGAR TARACESCLK VRARWFCAAD DAFLCHGCDN MVHSANQLAR RHERVKLQTA  60
SSKVNYSVTL NQNNNVAWHS GFTRKARTPR HNSKHVTVQL QEQQKKIVHE EVFFNNTISL  120
PLVPELGSEE ALHNYESEEQ LLCRVPVFDA ELCSVYNEVK EEVLAGEEVF DLDNFSSELL  180
PSDMDLAEFA ADVESLLGNG ADEDSSEHVK GSELLLDCKE EDEEMDACVD AVGAKETMVK  240
VKDEEELDSD TPCHLDSIIL DMNSEAFNWN DIVESESLAQ EQEEEASTVG ADKKDMFLRL  300
NYEDVISAWA SQGCSPWTTG TPPNFNSDDC WPDFLGSNGG DVQCCYGEMK SLRGHADGGR  360
EARVSRYREK RRTRLFAKKI RYEVRKLNAE KRPRMKGRFV KRTSIALPA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1370386RRTRLFAKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511026.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0L9VHX80.0A0A0L9VHX8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3TCC00.0A0A0S3TCC0_PHAAN; Uncharacterized protein
STRINGGLYMA07G10161.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.15e-94B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]